NOP10 monoclonal antibody (M01), clone 6H6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NOP10 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (32.78 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NOP10.
Immunogen
NOP10 (NP_061118.1, 1 a.a. ~ 64 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.78 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NOP10 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — NOP10
Entrez GeneID
55505GeneBank Accession#
NM_018648Protein Accession#
NP_061118.1Gene Name
NOP10
Gene Alias
MGC70651, NOLA3, NOP10P
Gene Description
NOP10 ribonucleoprotein homolog (yeast)
Omim ID
606471Gene Ontology
HyperlinkGene Summary
This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the DKC1, NOLA1 and NOLA2 proteins. These four H/ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. The four H/ACA snoRNP proteins are also components of the telomerase complex. This gene encodes a protein related to Saccharomyces cerevisiae Nop10p. [provided by RefSeq
Other Designations
homolog of yeast Nop10p|nucleolar protein family A, member 3|nucleolar protein family A, member 3 (H/ACA small nucleolar RNPs)
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com