Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF19 (Human) Recombinant ProteinHuPro Protein

  • Catalog # : H00055504-H01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Purified TNFRSF19 (AAH47321.1 30 a.a. - 170 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Transfected Cell Line:
  • Human HEK293T cells
  • Sequence:
  • ESGDCRQQEFRDRSGNCVPCNQCGPGMELSKECGFGYGEDAQCVACRLHRFKEDWGFQKCKPCLDCAVVNRFQKANCSATSDAICGDCLPGFYRKTKLVGFQDMECVPCGDPPPPYEPHCASKVNLVKIASTASSPRDTAL
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 20.79
  • Form:
  • Liquid
  • Preparation Method:
  • Transfection of pSuper-TNFRSF19 plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
  • Purification:
  • Strep-Tactin affinity columns
  • Concentration:
  • ≥ 10 ug/ml
  • Activity:
  • Not Tested
  • Quality Control Testing:
  • SDS-PAGE and Western Blot
    SDS-PAGE Gel
    QC Testing of H00055504-H01

    Western Blot
    QC Testing of H00055504-H01
  • Storage Buffer:
  • 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Application Image
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Gene Information
  • Gene Name:
  • TNFRSF19
  • Gene Alias:
  • TAJ,TAJ-alpha,TRADE,TROY
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 19
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is highly expressed during embryonic development. It has been shown to interact with TRAF family members, and to activate JNK signaling pathway when overexpressed in cells. This receptor is capable of inducing apoptosis by a caspase-independent mechanism, and it is thought to play an essential role in embryonic development. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000018113,OTTHUMP00000018114,toxicity and JNK inducer
  • RSS
  • YouTube
  • Linkedin
  • Facebook