Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ETNK1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00055500-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ETNK1 partial ORF ( NP_061108, 133 a.a. - 228 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • WDPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.3
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00055500-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • ETNK1
  • Gene Alias:
  • EKI,EKI1,Nbla10396
  • Gene Description:
  • ethanolamine kinase 1
  • Gene Summary:
  • This gene encodes an ethanolamine kinase, which functions in the first committed step of the phosphatidylethanolamine synthesis pathway. This cytosolic enzyme is specific for ethanolamine and exhibits negligible kinase activity on choline. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq
  • Other Designations:
  • putative protein product of Nbla10396
  • RSS
  • YouTube
  • Linkedin
  • Facebook