STRADB monoclonal antibody (M02), clone 3E11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
STRADB monoclonal antibody (M02), clone 3E11. Western Blot analysis of STRADB expression in human pancreas.
Western Blot (Cell lysate)
STRADB monoclonal antibody (M02), clone 3E11. Western Blot analysis of STRADB expression in MCF-7.
Western Blot (Transfected lysate)
Western Blot analysis of STRADB expression in transfected 293T cell line by STRADB monoclonal antibody (M02), clone 3E11.
Lane 1: STRADB transfected lysate (Predicted MW: 47 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STRADB is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant STRADB.
Immunogen
STRADB (AAH08302, 319 a.a. ~ 418 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SSGTHTVNSDRLHTPSSKTFSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDEKDSYWEF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (89)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
STRADB monoclonal antibody (M02), clone 3E11. Western Blot analysis of STRADB expression in human pancreas.Western Blot (Cell lysate)
STRADB monoclonal antibody (M02), clone 3E11. Western Blot analysis of STRADB expression in MCF-7.Western Blot (Transfected lysate)
Western Blot analysis of STRADB expression in transfected 293T cell line by STRADB monoclonal antibody (M02), clone 3E11.
Lane 1: STRADB transfected lysate (Predicted MW: 47 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STRADB is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — STRADB
Entrez GeneID
55437GeneBank Accession#
BC008302Protein Accession#
AAH08302Gene Name
STRADB
Gene Alias
ALS2CR2, CALS-21, ILPIP, ILPIPA, MGC102916, PAPK, PRO1038
Gene Description
STE20-related kinase adaptor beta
Omim ID
607333Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that belongs to the serine/threonine protein kinase STE20 subfamily. One of the active site residues in the protein kinase domain of this protein is altered, and it is thus a pseudokinase. This protein is a component of a complex involved in the activation of serine/threonine kinase 11, a master kinase that regulates cell polarity and energy-generating metabolism. This complex regulates the relocation of this kinase from the nucleus to the cytoplasm, and it is essential for G1 cell cycle arrest mediated by this kinase. The protein encoded by this gene can also interact with the X chromosome-linked inhibitor of apoptosis protein, and this interaction enhances the anti-apoptotic activity of this protein via the JNK1 signal transduction pathway. Two pseudogenes, located on chromosomes 1 and 7, have been found for this gene. [provided by RefSeq
Other Designations
ILP-interacting protein ILPIPA|STRAD beta|amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 2|pseudokinase ALS2CR2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com