PI4KII purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PI4K2A MaxPab polyclonal antibody. Western Blot analysis of PI4K2A expression in HepG2.
Western Blot (Transfected lysate)
Western Blot analysis of PI4KII expression in transfected 293T cell line by PI4KII MaxPab polyclonal antibody.
Lane 1: PI4KII transfected lysate(52.69 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PI4KII protein.
Immunogen
PI4KII (NP_060895.1, 1 a.a. ~ 479 a.a) full-length human protein.
Sequence
MDETSPLVSPERAQPPDYTFPSGSGAHFPQVPGGAVRVAAAAGSGPSPPGSPGHDRERQPLLDRARGAAAQGQTQTVAAQAQALAAQAAAAAHAAQAHRERNEFPEDPEFEAVVRQAELAIERCIFPERIYQGSSGSYFVKDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCCFGRDCLVLNQGYLSEAGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLALEKVPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAEPLPENTNRQLLLQFERLVVLDYIIRNTDRGNDNWLIKYDCPMDSSSSRDTDWVVVKEPVIKVAAIDNGLAFPLKHPDSWRAYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (94)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PI4K2A MaxPab polyclonal antibody. Western Blot analysis of PI4K2A expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of PI4KII expression in transfected 293T cell line by PI4KII MaxPab polyclonal antibody.
Lane 1: PI4KII transfected lysate(52.69 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PI4K2A
Entrez GeneID
55361GeneBank Accession#
NM_018425Protein Accession#
NP_060895Gene Name
PI4K2A
Gene Alias
DKFZp761G1923, PI4KII, PIK42A, RP11-548K23.6
Gene Description
phosphatidylinositol 4-kinase type 2 alpha
Omim ID
609763Gene Ontology
HyperlinkGene Summary
Phosphatidylinositolpolyphosphates (PtdInsPs) are centrally involved in many biologic processes, ranging from cell growth and organization of the actin cytoskeleton to endo- and exocytosis. PI4KII phosphorylates PtdIns at the D-4 position, an essential step in the biosynthesis of PtdInsPs (Barylko et al., 2001 [PubMed 11244087]).[supplied by OMIM
Other Designations
OTTHUMP00000020224|phosphatidylinositol 4-kinase type II (PI4KII)
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com