VNN3 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human VNN3 partial ORF ( NP_060869.2, 175 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
ARYHKYNLFAPEIQFDFPKDSELVTFDTPFGKFGIFTCFDIFSHDPAVVVVDEFQLTAFSTPQHGTTRCPSSRLFPSIQHGPRPWESIYLLQIPTTPACT
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — VNN3
Entrez GeneID
55350GeneBank Accession#
NM_018399Protein Accession#
NP_060869.2Gene Name
VNN3
Gene Alias
HSA238982, MGC171203, PAGEL-beta, PAGEL-eta, PAGEL-zeta
Gene Description
vanin 3
Omim ID
606592Gene Ontology
HyperlinkGene Summary
This gene is the central gene in a cluster of three vanin genes on chromosome 6q23-q24. The open reading frame is disrupted by a frameshift, and all splice variants that have been described are candidates for nonsense-mediated decay (NMD). Consequently, it is unlikely that this gene expresses a protein in vivo, so it is classified as a pseudogene. Extensive alternative splicing has been described; the two most common variants are represented as RefSeqs. [provided by RefSeq
Other Designations
PAGEL-alpha|PAGEL-delta|PAGEL-epsilon|PAGEL-gamma|pantetheinase|pantetheinase-associated gene expressed in leukocytes (PAGEL)-alpha|vanin 3, isoform 3
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com