Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

VNN3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00055350-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human VNN3 partial ORF ( NP_060869.2, 175 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • ARYHKYNLFAPEIQFDFPKDSELVTFDTPFGKFGIFTCFDIFSHDPAVVVVDEFQLTAFSTPQHGTTRCPSSRLFPSIQHGPRPWESIYLLQIPTTPACT
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00055350-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • VNN3
  • Gene Alias:
  • HSA238982,MGC171203,PAGEL-beta,PAGEL-eta,PAGEL-zeta
  • Gene Description:
  • vanin 3
  • Gene Summary:
  • This gene is the central gene in a cluster of three vanin genes on chromosome 6q23-q24. The open reading frame is disrupted by a frameshift, and all splice variants that have been described are candidates for nonsense-mediated decay (NMD). Consequently, it is unlikely that this gene expresses a protein in vivo, so it is classified as a pseudogene. Extensive alternative splicing has been described; the two most common variants are represented as RefSeqs. [provided by RefSeq
  • Other Designations:
  • PAGEL-alpha,PAGEL-delta,PAGEL-epsilon,PAGEL-gamma,pantetheinase,pantetheinase-associated gene expressed in leukocytes (PAGEL)-alpha,vanin 3, isoform 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook