FBXL8 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human FBXL8 protein.
Immunogen
FBXL8 (NP_060848.2, 1 a.a. ~ 374 a.a) full-length human protein.
Sequence
MAEPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGMLPPYLSACLDHIHNLRLEFEPSRKPSRRAAIELLMVLAGRAPGLRGLRLECRGEKPLFDAGRDVLEAVHAVCGAASQLRHLDLRRLSFTLDDALVLQAARSCPELHSLFLDNSTLVGSVGPGSVLELLEACPRLRALGLHLASLSHAILEALAAPDRAPFALLALRCACPEDARASPLPNEAWVALRRRHPGLAVELELEPALPAESVTRVLQPAVPVAALRLNLSGDTVGPVRFAAHHYAATLCALEVRAAASAELNAALEELAARCAALREVHCFCVVSHSVLDAFRAHCPRLRTYTLKLTREPHPWRPTLVA
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78); Rat (78)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FBXL8 expression in transfected 293T cell line (H00055336-T01) by FBXL8 MaxPab polyclonal antibody.
Lane 1: FBXL8 transfected lysate(40.5 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of FBXL8 transfected lysate using anti-FBXL8 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with FBXL8 purified MaxPab mouse polyclonal antibody (B01P) (H00055336-B01P). -
Gene Info — FBXL8
Entrez GeneID
55336GeneBank Accession#
NM_018378.2Protein Accession#
NP_060848.2Gene Name
FBXL8
Gene Alias
FBL8, FLJ11278, MGC19959
Gene Description
F-box and leucine-rich repeat protein 8
Omim ID
609077Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class. It shares 78% sequence identity with the mouse protein. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com