FBXW7 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human FBXW7 full-length ORF (BAA91986.1, 1 a.a. - 553 a.a.) recombinant protein with GST tag at N-terminal.
Sequence
MGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
88.7
Interspecies Antigen Sequence
Mouse (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — FBXW7
Entrez GeneID
55294GeneBank Accession#
AK001933.1Protein Accession#
BAA91986.1Gene Name
FBXW7
Gene Alias
AGO, CDC4, DKFZp686F23254, FBW6, FBW7, FBX30, FBXO30, FBXW6, FLJ16457, SEL-10, SEL10
Gene Description
F-box and WD repeat domain containing 7
Omim ID
606278Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene was previously referred to as FBX30, and belongs to the Fbws class; in addition to an F-box, this protein contains 7 tandem WD40 repeats. This protein binds directly to cyclin E and probably targets cyclin E for ubiquitin-mediated degradation. Mutations in this gene are detected in ovarian and breast cancer cell lines, implicating the gene's potential role in the pathogenesis of human cancers. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq
Other Designations
F-box and WD-40 domain protein 7 (archipelago homolog, Drosophila)|F-box protein FBW7|F-box protein SEL-10|archipelago homolog|archipelago, Drosophila, homolog of|homolog of C elegans sel-10
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
An engineered platform for reconstituting functional multisubunit SCF E3 ligase in vitro.
Huihui Liu, Simiao Liu, Hong Yu, Xiahe Huang, Yingchun Wang, Liang Jiang, Xiangbing Meng, Guifu Liu, Mingjiang Chen, Yanhui Jing, Feifei Yu, Bing Wang, Jiayang Li.
Molecular Plant 2022 Aug; 15(8):1285.
Application：enzyme reconstitution, Human, E3 ligase.
-
The pseudophosphatase STYX targets the F-box of FBXW7 and inhibits SCFFBXW7 function.
Reiterer V, Figueras-Puig C, Le Guerroue F, Confalonieri S, Vecchi M, Jalapothu D, Kanse SM, Deshaies RJ, Di Fiore PP, Behrends C, Farhan H.
The EMBO Journal 2016 Dec; 36(3):260.
Application：PI, WB, Recombinant protein.
-
An engineered platform for reconstituting functional multisubunit SCF E3 ligase in vitro.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com