FBXW7 monoclonal antibody (M06), clone 1C11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FBXW7.
Immunogen
FBXW7 (NP_361014, 599 a.a. ~ 707 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — FBXW7
Entrez GeneID
55294GeneBank Accession#
NM_033632Protein Accession#
NP_361014Gene Name
FBXW7
Gene Alias
AGO, CDC4, DKFZp686F23254, FBW6, FBW7, FBX30, FBXO30, FBXW6, FLJ16457, SEL-10, SEL10
Gene Description
F-box and WD repeat domain containing 7
Omim ID
606278Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene was previously referred to as FBX30, and belongs to the Fbws class; in addition to an F-box, this protein contains 7 tandem WD40 repeats. This protein binds directly to cyclin E and probably targets cyclin E for ubiquitin-mediated degradation. Mutations in this gene are detected in ovarian and breast cancer cell lines, implicating the gene's potential role in the pathogenesis of human cancers. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq
Other Designations
F-box and WD-40 domain protein 7 (archipelago homolog, Drosophila)|F-box protein FBW7|F-box protein SEL-10|archipelago homolog|archipelago, Drosophila, homolog of|homolog of C elegans sel-10
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com