Product Browser

Last updated: 2017/1/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BRF2 polyclonal antibody (A01)

  • Catalog # : H00055290-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant BRF2.
  • Immunogen:
  • BRF2 (NP_060780, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MPGRGRCPDCGSTELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00055290-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • BRF2 polyclonal antibody (A01), Lot # 060707JCS1. Western Blot analysis of BRF2 expression in human ovarian cancer.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • BRF2
  • Gene Alias:
  • BRFU,FLJ11052,TFIIIB50
  • Gene Description:
  • BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like
  • Gene Summary:
  • This gene encodes one of the multiple subunits of the RNA polymerase III transcription factor complex required for transcription of genes with promoter elements upstream of the initiation site. The product of this gene, a TFIIB-like factor, is directly recruited to the TATA-box of polymerase III small nuclear RNA gene promoters through its interaction with the TATA-binding protein. [provided by RefSeq
  • Other Designations:
  • RNA polymerase III transcription initiation factor BRF2,RNA polymerase III transcription initiation factor BRFU,transcription factor IIB- related factor, TFIIIB50
  • RSS
  • YouTube
  • Linkedin
  • Facebook