Product Browser

Last updated: 2017/10/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ADI1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00055256-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human ADI1 protein.
  • Immunogen:
  • ADI1 (NP_060739.1, 1 a.a. ~ 179 a.a) full-length human protein.
  • Sequence:
  • MVLAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ADI1 expression in transfected 293T cell line (H00055256-T02) by ADI1 MaxPab polyclonal antibody.

    Lane 1: MTCBP-1 transfected lysate(19.69 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • ADI1
  • Gene Alias:
  • APL1,ARD,FLJ10913,HMFT1638,MTCBP-1,MTCBP1,SIP-L,SIPL
  • Gene Description:
  • acireductone dioxygenase 1
  • Gene Summary:
  • This gene encodes an enzyme that belongs to the aci-reductone dioxygenase family of metal-binding enzymes, which are involved in methionine salvage. This enzyme may regulate mRNA processing in the nucleus, and may carry out different functions depending on its localization. A pseudogene that is located on chromosome 20 has been defined for this gene. [provided by RefSeq
  • Other Designations:
  • 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase,MT1-MMP cytoplasmic tail-binding protein-1,membrane-type 1 matrix metalloproteinase cytoplasmic tail binding protein-1,submergence induced protein 2
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook