UBA6 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
FLJ10808 MaxPab polyclonal antibody. Western Blot analysis of FLJ10808 expression in human spleen.
Western Blot (Transfected lysate)
Western Blot analysis of UBA6 expression in transfected 293T cell line (H00055236-T01) by UBA6 MaxPab polyclonal antibody.
Lane 1: FLJ10808 transfected lysate(42.79 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human UBA6 protein.
Immunogen
UBA6 (AAH31637.1, 1 a.a. ~ 389 a.a) full-length human protein.
Sequence
MEGSEPVAAHQGEEASCSSWGTGSTNKNLPIMSTASVEIDDALYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLEIAKNLVLAGIKAVTIHDTEKCQAWDLGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSSVPFNETTDLSFLDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDFGDEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFREINGMTGLNGSIQQITVISPFSFSIGDTTELEPYLHGGIAVQVKTPKTVFFESLERQLKHPKCLIVDFSNPEAPLEIHTAMLALDQFQEKYSRKPNVGCQQDSEELLKLATSISETLEEKVTIEIYGCPNICLLIHKCSVY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (84)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FLJ10808 MaxPab polyclonal antibody. Western Blot analysis of FLJ10808 expression in human spleen.Western Blot (Transfected lysate)
Western Blot analysis of UBA6 expression in transfected 293T cell line (H00055236-T01) by UBA6 MaxPab polyclonal antibody.
Lane 1: FLJ10808 transfected lysate(42.79 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — UBA6
Entrez GeneID
55236GeneBank Accession#
BC031637.1Protein Accession#
AAH31637.1Gene Name
UBA6
Gene Alias
FLJ10808, FLJ23367, MOP-4, UBE1L2
Gene Description
ubiquitin-like modifier activating enzyme 6
Omim ID
611361Gene Ontology
HyperlinkGene Summary
Modification of proteins with ubiquitin (UBB; MIM 191339) or ubiquitin-like proteins controls many signaling networks and requires a ubiquitin-activating enzyme (E1), a ubiquitin conjugating enzyme (E2), and a ubiquitin protein ligase (E3). UBE1L2 is an E1 enzyme that initiates the activation and conjugation of ubiquitin-like proteins (Jin et al., 2007 [PubMed 17597759]).[supplied by OMIM
Other Designations
UBA6, ubiquitin-activating enzyme E1|ubiquitin-activating enzyme E1-like 2
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com