Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RCBTB1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00055213-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RCBTB1 partial ORF ( NP_060661.3, 2 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • VDVGKWPIFTLLSPQEIASIRKACVFGTSASEALYVTDNDEVFVFGLNYSNCLGTGDNQSTLVPKKLEGLCGKKIKSLSYGSGPHVLLS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.53
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00055213-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • RCBTB1
  • Gene Alias:
  • CLLD7,CLLL7,GLP,MGC33184,RP11-185C18.1
  • Gene Description:
  • regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1
  • Gene Summary:
  • This gene encodes a protein with an N-terminal RCC1 domain and a C-terminal BTB (broad complex, tramtrack and bric-a-brac) domain. In rat, over-expression of this gene in vascular smooth muscle cells induced cellular hypertrophy. In rat, the C-terminus of RCBTB1 interacts with the angiotensin II receptor-1A. In humans, this gene maps to a region of chromosome 13q that is frequently deleted in B-cell chronic lymphocytic leukemia and other lymphoid malignancies. [provided by RefSeq
  • Other Designations:
  • GDP/GTP exchange factor (GEF)-like protein,OTTHUMP00000018413,chronic lymphocytic leukemia deletion region gene 7
  • RSS
  • YouTube
  • Linkedin
  • Facebook