Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RPRD1A polyclonal antibody (A01)

  • Catalog # : H00055197-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant RPRD1A.
  • Immunogen:
  • RPRD1A (NP_060640, 76 a.a. ~ 170 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • EFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLVRAL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00055197-A01
    Western Blot detection against Immunogen (36.56 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • RPRD1A
  • Gene Alias:
  • FLJ10656,HsT3101,MGC19513,P15RS
  • Gene Description:
  • regulation of nuclear pre-mRNA domain containing 1A
  • Gene Summary:
  • P15RS is upregulated in cells overexpressing cyclin-dependent kinase inhibitor p15(INK4b) (CDKN2B; MIM 600431) and may have a role in cell cycle regulation (Liu et al., 2002 [PubMed 12470661]).[supplied by OMIM
  • Other Designations:
  • Cyclin-dependent kinase inhibitor 2B-related protein (p15INK4B-related protein),cyclin-dependent kinase 2B-inhibitor-related protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook