Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NUDT11 (Human) Recombinant Protein (P01)

  • Catalog # : H00055190-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NUDT11 full-length ORF ( CAL37484.1, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDRKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44.44
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • NUDT11
  • Gene Alias:
  • APS1,ASP1,DIPP3b,DIPP3beta,FLJ10628,hDIPP3beta
  • Gene Description:
  • nudix (nucleoside diphosphate linked moiety X)-type motif 11
  • Gene Summary:
  • NUDT11 belongs to a subgroup of phosphohydrolases that preferentially attack diphosphoinositol polyphosphates (Hidaka et al., 2002 [PubMed 12105228]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000023300,diphosphoinositol polyphosphate phosphohydrolase 3, beta,nudix-type motif 11
  • RSS
  • YouTube
  • Linkedin
  • Facebook