Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HRMT1L6 polyclonal antibody (A01)

  • Catalog # : H00055170-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant HRMT1L6.
  • Immunogen:
  • HRMT1L6 (NP_060607, 241 a.a. ~ 316 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ESEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAMED
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00055170-A01
    Western Blot detection against Immunogen (34.47 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PRMT6
  • Gene Alias:
  • FLJ10559,HRMT1L6
  • Gene Description:
  • protein arginine methyltransferase 6
  • Gene Summary:
  • Protein arginine N-methyltransferases, such as PRMT6, catalyze the sequential transfer of a methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins to form methylated arginine derivatives and S-adenosyl-L-homocysteine.[supplied by OMIM
  • Other Designations:
  • HMT1 hnRNP methyltransferase-like 6,protein arginine N-methyltransferase 6
  • RSS
  • YouTube
  • Linkedin
  • Facebook