DARS2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
DARS2 MaxPab rabbit polyclonal antibody. Western Blot analysis of DARS2 expression in human kidney.
Western Blot (Tissue lysate)
DARS2 MaxPab rabbit polyclonal antibody. Western Blot analysis of DARS2 expression in rat brain.
Western Blot (Cell lysate)
DARS2 MaxPab rabbit polyclonal antibody. Western Blot analysis of DARS2 expression in MCF-7.
Western Blot (Transfected lysate)
Western Blot analysis of DARS2 expression in transfected 293T cell line (H00055157-T01) by DARS2 MaxPab polyclonal antibody.
Lane 1: DARS2 transfected lysate(73.60 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human DARS2 protein.
Immunogen
DARS2 (NP_060592.2, 1 a.a. ~ 645 a.a) full-length human protein.
Sequence
MYFPSWLSQLYRGLSRPIRRTTQPIWGSLYRSLLQSSQRRIPEFSSFVVRTNTCGELRSSHLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAH
Host
Rabbit
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (85); Rat (85)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
DARS2 MaxPab rabbit polyclonal antibody. Western Blot analysis of DARS2 expression in human kidney.Western Blot (Tissue lysate)
DARS2 MaxPab rabbit polyclonal antibody. Western Blot analysis of DARS2 expression in rat brain.Western Blot (Cell lysate)
DARS2 MaxPab rabbit polyclonal antibody. Western Blot analysis of DARS2 expression in MCF-7.Western Blot (Transfected lysate)
Western Blot analysis of DARS2 expression in transfected 293T cell line (H00055157-T01) by DARS2 MaxPab polyclonal antibody.
Lane 1: DARS2 transfected lysate(73.60 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — DARS2
Entrez GeneID
55157GeneBank Accession#
NM_018122.3Protein Accession#
NP_060592.2Gene Name
DARS2
Gene Alias
ASPRS, FLJ10514, LBSL, MT-ASPRS, RP3-383J4.2
Gene Description
aspartyl-tRNA synthetase 2, mitochondrial
Gene Ontology
HyperlinkGene Summary
O
Other Designations
OTTHUMP00000032692|aspartate tRNA ligase 2, mitochondrial
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com