THAP1 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
THAP1 MaxPab rabbit polyclonal antibody. Western Blot analysis of THAP1 expression in Jurkat.
Western Blot (Transfected lysate)
Western Blot analysis of THAP1 expression in transfected 293T cell line (H00055145-T02) by THAP1 MaxPab polyclonal antibody.
Lane 1: THAP1 transfected lysate(24.9 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of THAP1 transfected lysate using anti-THAP1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with THAP1 purified MaxPab mouse polyclonal antibody (B01P) (H00055145-B01P).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human THAP1 protein.
Immunogen
THAP1 (NP_060575.1, 1 a.a. ~ 213 a.a) full-length human protein.
Sequence
MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (92)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
THAP1 MaxPab rabbit polyclonal antibody. Western Blot analysis of THAP1 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of THAP1 expression in transfected 293T cell line (H00055145-T02) by THAP1 MaxPab polyclonal antibody.
Lane 1: THAP1 transfected lysate(24.9 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of THAP1 transfected lysate using anti-THAP1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with THAP1 purified MaxPab mouse polyclonal antibody (B01P) (H00055145-B01P). -
Gene Info — THAP1
Entrez GeneID
55145GeneBank Accession#
NM_018105.2Protein Accession#
NP_060575.1Gene Name
THAP1
Gene Alias
FLJ10477, MGC33014
Gene Description
THAP domain containing, apoptosis associated protein 1
Omim ID
609520Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains a THAP domain, a conserved DNA-binding domain. This protein colocalizes with the apoptosis response protein PAWR/PAR-4 in promyelocytic leukemia (PML) nuclear bodies, and functions as a proapoptotic factor that links PAWR to PML nuclear bodies. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq
Other Designations
4833431A01Rik|THAP domain protein 1|nuclear proapoptotic factor
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com