WIPI1 monoclonal antibody (M02), clone 3C1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant WIPI1.
Immunogen
WIPI1 (NP_060453.2, 348 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRGNQKGKTKQ
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
WIPI1 monoclonal antibody (M02), clone 3C1 Western Blot analysis of WIPI1 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged WIPI1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — WIPI1
Entrez GeneID
55062GeneBank Accession#
NM_017983Protein Accession#
NP_060453.2Gene Name
WIPI1
Gene Alias
ATG18, FLJ10055, WIPI49
Gene Description
WD repeat domain, phosphoinositide interacting 1
Omim ID
609224Gene Ontology
HyperlinkGene Summary
WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI subfamily of WD40 repeat proteins, such as WIPI1, have a 7-bladed propeller structure and contain a conserved motif for interaction with phospholipids (Proikas-Cezanne et al., 2004 [PubMed 15602573]).[supplied by OMIM
Other Designations
WD40 repeat protein Interacting with phosphoInositides of 49kDa|WIPI-1 alpha
-
Interactome
-
Publication Reference
-
Automated Detection of Autophagy Response Using Single Cell-Based Microscopy Assays.
Mueller AJ, Proikas-Cezanne T.
Methods in Molecular Biology (Clifton, N.J.) 2019 Jan; 1880:429.
Application:IF, Human, CRL-1424, G-361, HTB-96, Human skin, U-2 OS cells.
-
Automated Detection of Autophagy Response Using Single Cell-Based Microscopy Assays.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com