FKBP14 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
FKBP14 MaxPab polyclonal antibody. Western Blot analysis of FKBP14 expression in human kidney.
Western Blot (Transfected lysate)
Western Blot analysis of FKBP14 expression in transfected 293T cell line (H00055033-T01) by FKBP14 MaxPab polyclonal antibody.
Lane 1: FKBP14 transfected lysate(23.21 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human FKBP14 protein.
Immunogen
FKBP14 (NP_060416.1, 1 a.a. ~ 211 a.a) full-length human protein.
Sequence
MRLFLWNAVLTLFVTSLIGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDEL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (93)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FKBP14 MaxPab polyclonal antibody. Western Blot analysis of FKBP14 expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of FKBP14 expression in transfected 293T cell line (H00055033-T01) by FKBP14 MaxPab polyclonal antibody.
Lane 1: FKBP14 transfected lysate(23.21 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — FKBP14
Entrez GeneID
55033GeneBank Accession#
NM_017946.2Protein Accession#
NP_060416.1Gene Name
FKBP14
Gene Alias
FKBP22, FLJ20731
Gene Description
FK506 binding protein 14, 22 kDa
Gene Ontology
HyperlinkGene Summary
O
Other Designations
FK506 binding protein 14
-
Interactome
-
Publication Reference
-
Kyphoscoliotic Ehlers-Danlos syndrome caused by pathogenic variants in FKBP14: further insights into the phenotypic spectrum and pathogenic mechanisms.
Marlies Colman, Robin Vroman, Tibbe Dhooge, Zoë Malfait, Sofie Symoens, Biruté Burnyté, Sheela Nampoothiri, Ariana Kariminejad, Fransiska Malfait, Delfien Syx.
Human Mutation 2022 Dec; 43(12):1994.
Application：WB, Human, Human skin tissue.
-
Transcriptome analysis of skin fibroblasts with dominant negative COL3A1 mutations provides molecular insights into the etiopathology of vascular Ehlers-Danlos syndrome.
Chiarelli N, Carini G, Zoppi N, Ritelli M, Colombi M.
PLoS One 2018 Jan; 13(1):e0191220.
Application：IF, WB, Human, Human skin fibroblasts.
-
Mutations in FKBP14 cause a variant of Ehlers-Danlos syndrome with progressive kyphoscoliosis, myopathy, and hearing loss.
Baumann M, Giunta C, Krabichler B, Rüschendorf F, Zoppi N, Colombi M, Bittner RE, Quijano-Roy S, Muntoni F, Cirak S, Schreiber G, Zou Y, Hu Y, Romero NB, Carlier RY, Amberger A, Deutschmann A, Straub V, Rohrbach M, Steinmann B, Rostásy K, Karall D, Bönnemann CG, Zschocke J, Fauth C.
American Journal of Human Genetics 2012 Feb; 90(2):201.
Application：WB-Ce, Human, Human skin fibroblasts.
-
Kyphoscoliotic Ehlers-Danlos syndrome caused by pathogenic variants in FKBP14: further insights into the phenotypic spectrum and pathogenic mechanisms.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com