PHIP monoclonal antibody (M01), clone 4D7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PHIP is 0.1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to PHIP on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.51 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PHIP.
Immunogen
PHIP (NP_060404, 1599 a.a. ~ 1705 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TLSKSSAVIEQGDCKNNALVPGTIQVNGHGGQPSKLVKRGPGRKPKVEVNTNSGEIIHKKRGRKPKKLQYAKPEDLEQNNVHPIRDEVLPSSTCNFLSETNNVKEDL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83); Rat (80)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.51 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PHIP is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PHIP on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — PHIP
Entrez GeneID
55023GeneBank Accession#
NM_017934Protein Accession#
NP_060404Gene Name
PHIP
Gene Alias
FLJ20705, FLJ45918, MGC90216, WDR11, ndrp
Gene Description
pleckstrin homology domain interacting protein
Gene Ontology
HyperlinkGene Summary
PHIP binds the pleckstrin homology (PH) domain of insulin receptor substrate-1 (IRS1; MIM 147545), modulates insulin signaling, and plays a role in pancreatic beta cell growth and survival (Farhang-Fallah et al., 2000 [PubMed 11018022]; Podcheko et al., 2007 [PubMed 17636024]).[supplied by OMIM
Other Designations
OTTHUMP00000016771
-
Interactome
-
Publication Reference
-
Pleckstrin homology domain-interacting protein (PHIP) as a marker and mediator of melanoma metastasis.
De Semir D, Nosrati M, Bezrookove V, Dar AA, Federman S, Bienvenu G, Venna S, Rangel J, Climent J, Meyer Tamgüney TM, Thummala S, Tong S, Leong SP, Haqq C, Billings P, Miller JR 3rd, Sagebiel RW, Debs R, Kashani-Sabet M.
PNAS 2012 May; 109(18):7067.
Application：IF, IHC-P, WB, Human, 1205Lu, D05, C8161.9, LOX cells, Human melanoma tissues.
-
Pleckstrin homology domain-interacting protein (PHIP) as a marker and mediator of melanoma metastasis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com