ZSCAN2 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ZSCAN2 full-length ORF ( NP_060364.3, 1 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MMAADIPRVTTPLSSLVQVPQEEDRQEEEVTTMILEDDSWVQEAVLQEDGPESEPFPQSAGKGGPQEEVTRGPQGALGRLRELCRRWLRPEVHTKEQMLTMLPKEIQAWLQEHRPESSEEAAALVEDLTQTLQDSAVAVFASLPVEVTSL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
43.1
Interspecies Antigen Sequence
Mouse (83); Rat (84)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ZSCAN2
Entrez GeneID
54993GeneBank Accession#
NM_017894.4Protein Accession#
NP_060364.3Gene Name
ZSCAN2
Gene Alias
FLJ20595, ZFP29, ZNF854
Gene Description
zinc finger and SCAN domain containing 2
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that this gene is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells. Alternative splicing of this gene results in several transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
zinc finger protein 29
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com