PINX1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PINX1.
Immunogen
PINX1 (AAH15479, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Sequence
MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEHGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDFNQLLAELNTCHGQETT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (72); Rat (70)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PINX1 polyclonal antibody (A01), Lot # 060509JCS1 Western Blot analysis of PINX1 expression in IMR-32 ( Cat # L008V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — PINX1
Entrez GeneID
54984GeneBank Accession#
BC015479Protein Accession#
AAH15479Gene Name
PINX1
Gene Alias
FLJ20565, LPTL, LPTS, MGC8850
Gene Description
PIN2-interacting protein 1
Omim ID
606505Gene Ontology
HyperlinkOther Designations
67-11-3 protein|hepatocellular carcinoma-related putative tumor suppressor
-
Interactome
-
Disease
-
Publication Reference
-
The effects of telomere shortening on cancer cells: A network model of proteomic and microRNA analysis.
Uziel O, Yosef N, Sharan R, Ruppin E, Kupiec M, Kushnir M, Beery E, Cohen-Diker T, Nordenberg J, Lahav M.
Genomics 2015 Jan; 105(1):5.
Application:WB, Human, SK-N-MC cells.
-
Plk1-mediated mitotic phosphorylation of PinX1 regulates its stability.
Wang C, Yu J, Yuan K, Lan J, Jin C, Huang H.
European Journal of Cell Biology 2010 Oct; 89(10):748.
Application:WB-Ce, WB-Tr, Human, HeLa cells.
-
PinX1 is recruited to the mitotic chromosome periphery by Nucleolin and facilitates chromosome congression.
Li N, Yuan K, Yan F, Huo Y, Zhu T, Liu X, Guo Z, Yao X.
Biochemical and Biophysical Research Communications 2009 Apr; 384(1):76.
Application:WB-Ce, WB-Tr, Human, HeLa cells.
-
The correlation of genetic instability of PINX1 gene to clinico-pathological features of gastric cancer in the Chinese population.
Ma Y, Wu L, Liu C, Xu L, Li D, Li JC.
Journal of Cancer Research and Clinical Oncology 2008 Sep; 135(3):431.
Application:IHC-P, Human, Human gastric cancer.
-
The effects of telomere shortening on cancer cells: A network model of proteomic and microRNA analysis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com