Product Browser

Last updated: 2017/6/18
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DUSP23 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00054935-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human DUSP23 protein.
  • Immunogen:
  • DUSP23 (NP_060293.2, 1 a.a. ~ 150 a.a) full-length human protein.
  • Sequence:
  • MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of DUSP23 expression in transfected 293T cell line (H00054935-T02) by DUSP23 MaxPab polyclonal antibody.

    Lane 1: DUSP23 transfected lysate(16.60 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • DUSP23
  • Gene Alias:
  • DUSP25,FLJ20442,LDP-3,MOSP,RP11-190A12.1,VHZ
  • Gene Description:
  • dual specificity phosphatase 23
  • Other Designations:
  • OTTHUMP00000024412,OTTHUMP00000024413,OTTHUMP00000033306,VH1-like member Z,low-molecular-mass dual-specificity phosphatase 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook