RHBDL2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human RHBDL2 partial ORF ( NP_060291.2, 1 a.a. - 72 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAAVHDLEMESMNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGTYLERANCFPPP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
33.66
Interspecies Antigen Sequence
Mouse (81); Rat (100)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — RHBDL2
Entrez GeneID
54933GeneBank Accession#
NM_017821Protein Accession#
NP_060291.2Gene Name
RHBDL2
Gene Alias
MGC16997, RRP2
Gene Description
rhomboid, veinlet-like 2 (Drosophila)
Omim ID
608962Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the rhomboid family of integral membrane proteins. This family contains proteins that are related to Drosophila rhomboid protein. Members of this family are found in both prokaryotes and eukaryotes and are thought to function as intramembrane serine proteases. The encoded protein is thought to release soluble growth factors by proteolytic cleavage of certain membrane-bound substrates, including ephrin B2 and ephrin B3. [provided by RefSeq
Other Designations
OTTHUMP00000000546|rhomboid (veinlet, Drosophila)-like 2|rhomboid-related protein 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com