Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UBE2R2 (Human) Recombinant Protein (P01)

  • Catalog # : H00054926-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human UBE2R2 full-length ORF ( AAH47584, 1 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNEES
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 51.92
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00054926-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • UBE2R2
  • Gene Alias:
  • CDC34B,FLJ20419,MGC10481,UBC3B
  • Gene Description:
  • ubiquitin-conjugating enzyme E2R 2
  • Gene Summary:
  • Protein kinase CK2 is a ubiquitous and pleiotropic Ser/Thr protein kinase involved in cell growth and transformation. This gene encodes a protein similar to the E2 ubiquitin conjugating enzyme UBC3/CDC34. Studies suggest that CK2-dependent phosphorylation of this ubiquitin-conjugating enzyme functions by regulating beta-TrCP substrate recognition and induces its interaction with beta-TrCP, enhancing beta-catenin degradation. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000000472,OTTHUMP00000021236,ubiquitin carrier protein R2,ubiquitin-conjugating enzyme UBC3B,ubiquitin-protein ligase R2
  • RSS
  • YouTube
  • Linkedin
  • Facebook