UBE2R2 monoclonal antibody (M01), clone 5E7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
UBE2R2 monoclonal antibody (M01), clone 5E7 Western Blot analysis of UBE2R2 expression in Jurkat ( Cat # L017V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of UBE2R2 expression in transfected 293T cell line by UBE2R2 monoclonal antibody (M01), clone 5E7.
Lane 1: UBE2R2 transfected lysate (Predicted MW: 27.2 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of UBE2R2 transfected lysate using anti-UBE2R2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with UBE2R2 monoclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UBE2R2 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (51.92 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant UBE2R2.
Immunogen
UBE2R2 (AAH47584, 1 a.a. ~ 238 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNEES
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2b kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (51.92 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
UBE2R2 monoclonal antibody (M01), clone 5E7 Western Blot analysis of UBE2R2 expression in Jurkat ( Cat # L017V1 ).Western Blot (Transfected lysate)
Western Blot analysis of UBE2R2 expression in transfected 293T cell line by UBE2R2 monoclonal antibody (M01), clone 5E7.
Lane 1: UBE2R2 transfected lysate (Predicted MW: 27.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of UBE2R2 transfected lysate using anti-UBE2R2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with UBE2R2 monoclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UBE2R2 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — UBE2R2
Entrez GeneID
54926GeneBank Accession#
BC047584Protein Accession#
AAH47584Gene Name
UBE2R2
Gene Alias
CDC34B, FLJ20419, MGC10481, UBC3B
Gene Description
ubiquitin-conjugating enzyme E2R 2
Gene Ontology
HyperlinkGene Summary
Protein kinase CK2 is a ubiquitous and pleiotropic Ser/Thr protein kinase involved in cell growth and transformation. This gene encodes a protein similar to the E2 ubiquitin conjugating enzyme UBC3/CDC34. Studies suggest that CK2-dependent phosphorylation of this ubiquitin-conjugating enzyme functions by regulating beta-TrCP substrate recognition and induces its interaction with beta-TrCP, enhancing beta-catenin degradation. [provided by RefSeq
Other Designations
OTTHUMP00000000472|OTTHUMP00000021236|ubiquitin carrier protein R2|ubiquitin-conjugating enzyme UBC3B|ubiquitin-protein ligase R2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com