PXK monoclonal antibody (M04), clone 4D11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PXK expression in transfected 293T cell line by PXK monoclonal antibody (M04), clone 4D11.
Lane 1: PXK transfected lysate(51.8 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PXK is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PXK.
Immunogen
PXK (AAH14479.1, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PDSVPVDSFPPAPSMAVVAVLESTLSCEACKNGMPTISRLLQMPLFSDVLLTTSEKPQFKIPTKLKEALRIAKECIEKRLIEEQKQIHQHRRLTRAQSHH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PXK expression in transfected 293T cell line by PXK monoclonal antibody (M04), clone 4D11.
Lane 1: PXK transfected lysate(51.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PXK is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — PXK
Entrez GeneID
54899GeneBank Accession#
BC014479Protein Accession#
AAH14479.1Gene Name
PXK
Gene Alias
FLJ20335, MONaKA
Gene Description
PX domain containing serine/threonine kinase
Omim ID
611450Gene Ontology
HyperlinkGene Summary
PXK binds to the Na,K-ATPase beta-1 (ATP1B1; MIM 182330) and beta-3 (ATP1B3; MIM 601867) subunits and modulates both Na,K-ATPase enzymatic and ion pump activities (Mao et al., 2005 [PubMed 16135750]).[supplied by OMIM
Other Designations
PX ser/thr kinase v2|PX serine/threonine kinase|modulator of Na,K-ATPase long form
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com