RP11-35N6.1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of RP11-35N6.1 expression in transfected 293T cell line (H00054886-T01) by RP11-35N6.1 MaxPab polyclonal antibody.
Lane 1: RP11-35N6.1 transfected lysate(35.75 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human RP11-35N6.1 protein.
Immunogen
RP11-35N6.1 (NP_060223, 1 a.a. ~ 325 a.a) full-length human protein.
Sequence
MAVGNNTQRSYSIIPCFIFVELVIMAGTVLLAYYFECTDTFQVHIQGFFCQDGDLMKPYPGTEEESFITPLVLYCVLAATPTAIIFIGEISMYFIKSTRESLIAQEKTILTGECCYLNPLLRRIIRFTGVFAFGLFATDIFVNAGQVVTGHLTPYFLTVCKPNYTSADCQAHHQFINNGNICTGDLEVIEKARRSFPSKHAALSIYSALYATMYITSTIKTKSSRLAKPVLCLGTLCTAFLTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVHNFKGTQGSPSKPKPEDPRGVPLMAFPRIESPLETLSAQNHSASMTEVT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RP11-35N6.1 expression in transfected 293T cell line (H00054886-T01) by RP11-35N6.1 MaxPab polyclonal antibody.
Lane 1: RP11-35N6.1 transfected lysate(35.75 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — RP11-35N6.1
Entrez GeneID
54886GeneBank Accession#
NM_017753Protein Accession#
NP_060223Gene Name
RP11-35N6.1
Gene Alias
MGC26189, PRG-3
Gene Description
plasticity related gene 3
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the plasticity-related gene (PRG) family. Members of the PRG family mediate lipid phosphate phosphatase activity in neurons and are known to be involved in neuronal plasticity. The protein encoded by this gene does not perform its function through enzymatic phospholipid degradation. This gene is strongly expressed in brain. It shows dynamic expression regulation during brain development and neuronal excitation. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq
Other Designations
OTTHUMP00000021800|OTTHUMP00000021801|lipid phosphate phosphatase-related protein type 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com