BCOR polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant BCOR.
Immunogen
BCOR (NP_060215, 1361 a.a. ~ 1460 a.a) partial recombinant protein with GST tag.
Sequence
RRFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSPQETTQSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKICDVNHRD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (89)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of BCOR expression in transfected 293T cell line by BCOR polyclonal antibody (A01).
Lane1:BCOR transfected lysate (Predicted MW: 36.74 KDa).
Lane2:Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — BCOR
Entrez GeneID
54880GeneBank Accession#
NM_017745Protein Accession#
NP_060215Gene Name
BCOR
Gene Alias
ANOP2, FLJ20285, FLJ38041, KIAA1575, MAA2, MCOPS2, MGC131961, MGC71031
Gene Description
BCL6 co-repressor
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene was identified as an interacting corepressor of BCL6, a POZ/zinc finger transcription repressor that is required for germinal center formation and may influence apoptosis. This protein selectively interacts with the POZ domain of BCL6, but not with eight other POZ proteins. Specific class I and II histone deacetylases (HDACs) have been shown to interact with this protein, which suggests a possible link between the two classes of HDACs. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
5830466J11Rik|8430401K06Rik|BCL-6 interacting corepressor|OTTHUMP00000025766|OTTHUMP00000025768
-
Interactome
-
Publication Reference
-
Proteomics Analysis of Ring1B/Rnf2 Interactors Identifies a Novel Complex with the Fbxl10/Jhdm1B Histone Demethylase and the Bcl6 Interacting Corepressor.
Sanchez C, Sanchez I, Demmers JA, Rodriguez P, Strouboulis J, Vidal M.
Molecular & Cellular Proteomics 2007 Feb; 6(5):820.
Application:WB, Mouse, MEL cells.
-
Proteomics Analysis of Ring1B/Rnf2 Interactors Identifies a Novel Complex with the Fbxl10/Jhdm1B Histone Demethylase and the Bcl6 Interacting Corepressor.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com