DPP8 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human DPP8 partial ORF ( NP_932065.1, 161 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
IGTVGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQPLRPNLVETSCPNIRMDPKLCPADPDWIAFIHSNDIWISNIVTR
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
34.98
Interspecies Antigen Sequence
Mouse (95)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — DPP8
Entrez GeneID
54878GeneBank Accession#
NM_197961Protein Accession#
NP_932065.1Gene Name
DPP8
Gene Alias
DP8, DPRP1, FLJ14920, FLJ20283, MGC26191, MSTP141
Gene Description
dipeptidyl-peptidase 8
Omim ID
606819Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the peptidase S9B family, a small family of dipeptidyl peptidases that are able to cleave peptide substrates at a prolyl bond. The encoded protein shares similarity with dipeptidyl peptidase IV in that it is ubiquitously expressed, and hydrolyzes the same substrates. These similarities suggest that, like dipeptidyl peptidase IV, this protein may play a role in T-cell activation and immune function. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
Other Designations
dipeptidyl peptidase 8|dipeptidyl peptidase IV-related protein-1|dipeptidyl peptidase VIII|dipeptidylpeptidase 8|prolyl dipeptidase DPP8
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com