Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PGPEP1 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00054858-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human PGPEP1 protein.
  • Immunogen:
  • PGPEP1 (NP_060182, 1 a.a. ~ 209 a.a) full-length human protein.
  • Sequence:
  • MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHSPQLVVHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVSVTISQDAGRYLCDFTYYTSLYQSHGRSAFVHVPPLGKPYNADQLGRALRAIIEEMLDLLEQSEGKINYCHKH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PGPEP1 expression in transfected 293T cell line (H00054858-T01) by PGPEP1 MaxPab polyclonal antibody.

    Lane 1: PGPEP1 transfected lysate(22.99 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • PGPEP1
  • Gene Alias:
  • FLJ20208,MGC10812,PGP,PGP-I,PGPI,Pcp
  • Gene Description:
  • pyroglutamyl-peptidase I
  • Gene Summary:
  • Pyroglutamyl peptidase I (EC 3.4.19.3) catalyzes the hydrolysis of N-terminal pyroglutamyl residues from oligopeptides and proteins.[supplied by OMIM
  • Other Designations:
  • 5-oxoprolyl-peptidase,pyrrolidone-carboxylate peptidase
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook