Product Browser

Last updated: 2017/8/20

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BSPRY purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00054836-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human BSPRY protein.
  • Immunogen:
  • BSPRY (AAH01477.1, 1 a.a. ~ 193 a.a) full-length human protein.
  • Sequence:
  • MSAEGAEPGPGSGSGPGPGPLCPEHGQALSWFCGSERRPVCAACAGLGGRCRGHRIRRAEERAEELRNKIVDQCERLQLQSAAITKYVADVLPGKNQRAVSMASAARELVIQRLSLVRSLCESEEQRLLEQVHGEEERAHQSILTQRVHWAEALQKLDTIRTGLVGMLTHLDDLQLIQKEQEIFERHRGHTDR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • 1.
  • A proteomic approach to study parathyroid glands.
    Giusti L, Cetani F, Ciregia F, Da Valle Y, Donadio E, Giannaccini G, Banti C, Pardi E, Saponaro F, Basolo F, Berti P, Miccoli P, Pinchera A, Marcocci C, Lucacchini A.Mol Biosyst. 2011 Mar;7(3):687-99. Epub 2010 Dec 21.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • BSPRY MaxPab polyclonal antibody. Western Blot analysis of BSPRY expression in human pancreas.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of BSPRY expression in transfected 293T cell line (H00054836-T01) by BSPRY MaxPab polyclonal antibody.

    Lane 1: BSPRY transfected lysate(21.23 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • BSPRY
  • Gene Alias:
  • FLJ20150
  • Gene Description:
  • B-box and SPRY domain containing
  • Other Designations:
  • B-box and SPRY-domain containing protein,OTTHUMP00000022728,zetin 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook