PC-LKC monoclonal antibody (M01), clone 1D2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PCDH24 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.73 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PCLKC.
Immunogen
PC-LKC (NP_060145, 210 a.a. ~ 318 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GGMYHNTFTIQCSLPVFLSISVVDQPDLDPQFVREFYSASVAEDAAKGTSVLTVEAVDGDKGINDPVIYSISYSTRPGWFDIGADGVIRVNGSLDREQLLEADEEVQLQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75); Rat (70)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PCDH24 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — PCDH24
Entrez GeneID
54825GeneBank Accession#
NM_017675Protein Accession#
NP_060145Gene Name
PCDH24
Gene Alias
FLJ20124, FLJ20383, MGC163154, PC-LKC, PCLKC
Gene Description
protocadherin 24
Gene Ontology
HyperlinkGene Summary
This gene is a member of the protocadherin family, which represents a subset of the larger cadherin superfamily. The members of the protocadherin family encode non-classical cadherins that function as calcium-dependent cell-cell adhesion molecules. The kidney-expressed gene product has a signal peptide, nine cadherin repeat domains and a unique cytoplasmic region. This protocadherin represents a new candidate for tumor suppression. [provided by RefSeq
Other Designations
protocadherin LKC
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com