PCSK4 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PCSK4 protein.
Immunogen
PCSK4 (AAH36354, 1 a.a. ~ 242 a.a) full-length human protein.
Sequence
MGTRSTLVAIRPLDVSTEGYNNWVFMSTHFWDENPQGVWTLGLENKGYYFNTGTLYRYTLLLYGTAEDMTARPTGPQVTSSACVQRDTEGLCQACDGPAYILGQLCLAYCPPRFFNHTRLVTAGPGHTAAPALRVCSSCHASCYTCRGGSPRDCTSCPPSSTLDQQQGSCMGPTTPDSRPRLRAAACPHHRCPASAMVLSLLAVTLGGPVLCGMSMDLPLYAWLSRARATPTKPQVWLPAGT
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (65); Rat (84)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PCSK4 MaxPab polyclonal antibody. Western Blot analysis of PCSK4 expression in rat brain.Western Blot (Transfected lysate)
Western Blot analysis of PCSK4 expression in transfected 293T cell line (H00054760-T01) by PCSK4 MaxPab polyclonal antibody.
Lane 1: PCSK4 transfected lysate(26.73 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PCSK4
Entrez GeneID
54760GeneBank Accession#
BC036354Protein Accession#
AAH36354Gene Name
PCSK4
Gene Alias
DKFZp434B217, MGC34749, PC4, SPC5
Gene Description
proprotein convertase subtilisin/kexin type 4
Omim ID
600487Gene Ontology
HyperlinkGene Summary
Proprotein convertases, including PCSK4, are calcium-dependent serine proteases related to bacterial subtilisins and to yeast kexin. These enzymes process precursor proteins to their active forms by selective cleavage of the polypeptide at sites following paired basic amino acids. In mammals, this family comprises PC1 (MIM 162150), PC2 (MIM 162151), PC4, PC5 (MIM 600488), furin (FUR; MIM 136950), and PACE4 (MIM 167405). Substrates for these enzymes range from prohormones to precursors for growth factors to cell surface receptors and viral surface glycoproteins (Cao et al., 2001 [PubMed 11776387]).[supplied by OMIM
Other Designations
OTTHUMP00000158677
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com