FBLIM1 monoclonal antibody (M03), clone 3F8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
FBLIM1 monoclonal antibody (M03), clone 3F8. Western Blot analysis of FBLIM1 expression in HepG2 ( Cat # L019V1 ).
Western Blot detection against Immunogen (37.18 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FBLIM1.
Immunogen
FBLIM1 (NP_060026, 270 a.a. ~ 373 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VTCARCIGDESFALGSQNEVYCLDDFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCRILLSVEPTDQGCYPLNNHLFCKPCHVKRSAAGCC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (59); Rat (74)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.18 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FBLIM1 monoclonal antibody (M03), clone 3F8. Western Blot analysis of FBLIM1 expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — FBLIM1
Entrez GeneID
54751GeneBank Accession#
NM_017556Protein Accession#
NP_060026Gene Name
FBLIM1
Gene Alias
CAL, DKFZp434G171, FBLP-1, FBLP1, RP11-169K16.5
Gene Description
filamin binding LIM protein 1
Omim ID
607747Gene Ontology
HyperlinkGene Summary
This gene encodes a protein with an N-terminal filamin-binding domain, a central proline-rich domain, and, multiple C-terminal LIM domains. This protein localizes at cell junctions and may link cell adhesion structures to the actin cytoskeleton. This protein may be involved in the assembly and stabilization of actin-filaments and likely plays a role in modulating cell adhesion, cell morphology and cell motility. This protein also localizes to the nucleus and may affect cardiomyocyte differentiation after binding with the CSX/NKX2-5 transcription factor. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
CSX-associated LIM|MIG2-interacting protein|OTTHUMP00000003118|OTTHUMP00000003119|OTTHUMP00000003120|filamin-binding LIM protein-1|migfilin|mitogen-inducible 2 interacting protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com