Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC6A20 (Human) Recombinant Protein (Q01)

  • Catalog # : H00054716-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SLC6A20 partial ORF ( NP_064593, 301 a.a. - 369 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSLESELDTAVQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33.33
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00054716-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • SLC6A20
  • Gene Alias:
  • MGC161475,SIT1,XT3,Xtrp3
  • Gene Description:
  • solute carrier family 6 (proline IMINO transporter), member 20
  • Gene Summary:
  • Transport of small hydrophilic substances across cell membranes is mediated by substrate-specific transporter proteins which have been classified into several families of related genes. The protein encoded by this gene is a member of the subgroup of transporter with unidentified substrates within the Na+ and Cl- coupled transporter family. This gene is expressed in kidney, and its alternative splicing generates 2 transcript variants. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000164648,OTTHUMP00000164649,X transporter protein 3,neurotransmitter transporter RB21A,orphan transporter XT3,sodium/imino-acid transporter 1,solute carrier family 6 (neurotransmitter transporter), member 20,solute carrier family 6, member 20
  • RSS
  • YouTube
  • Linkedin
  • Facebook