SLC6A20 monoclonal antibody (M02), clone 3G6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SLC6A20 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (33.33 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SLC6A20.
Immunogen
SLC6A20 (NP_064593, 301 a.a. ~ 369 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSLESELDTAVQ
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.33 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SLC6A20 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — SLC6A20
Entrez GeneID
54716GeneBank Accession#
NM_020208Protein Accession#
NP_064593Gene Name
SLC6A20
Gene Alias
MGC161475, SIT1, XT3, Xtrp3
Gene Description
solute carrier family 6 (proline IMINO transporter), member 20
Omim ID
605616Gene Ontology
HyperlinkGene Summary
Transport of small hydrophilic substances across cell membranes is mediated by substrate-specific transporter proteins which have been classified into several families of related genes. The protein encoded by this gene is a member of the subgroup of transporter with unidentified substrates within the Na+ and Cl- coupled transporter family. This gene is expressed in kidney, and its alternative splicing generates 2 transcript variants. [provided by RefSeq
Other Designations
OTTHUMP00000164648|OTTHUMP00000164649|X transporter protein 3|neurotransmitter transporter RB21A|orphan transporter XT3|sodium/imino-acid transporter 1|solute carrier family 6 (neurotransmitter transporter), member 20|solute carrier family 6, member 20
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com