Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MARCH5 polyclonal antibody (A01)

  • Catalog # : H00054708-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MARCH5.
  • Immunogen:
  • MARCH5 (NP_060294.1, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MPDQALQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVYVLDLADRLISK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00054708-A01
    Western Blot detection against Immunogen (36.56 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • MARCH5
  • Gene Alias:
  • FLJ20445,MARCH-V,MITOL,RNF153
  • Gene Description:
  • membrane-associated ring finger (C3HC4) 5
  • Gene Summary:
  • MARCH5 is a ubiquitin ligase of the mitochondrial outer membrane that plays a role in the control of mitochondrial morphology by regulating mitofusin-2 (MFN2; MIM 608507) and DRP1 (DNM1L; MIM 603850) (Nakamura et al., 2006 [PubMed 16936636]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000020096,membrane-associated RING-CH protein V,mitochondrial ubiquitin ligase,ring finger protein 153
  • RSS
  • YouTube
  • Linkedin
  • Facebook