CROT monoclonal antibody (M01), clone 1A6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CROT monoclonal antibody (M01), clone 1A6. Western Blot analysis of CROT expression in Raw 264.7 ( Cat # L024V1 ).
Western Blot (Cell lysate)
CROT monoclonal antibody (M01), clone 1A6 Western Blot analysis of CROT expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
CROT monoclonal antibody (M01), clone 1A6. Western Blot analysis of CROT expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Cell lysate)
CROT monoclonal antibody (M01), clone 1A6. Western Blot analysis of CROT expression in PC-12 ( Cat # L012V1 ).
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CROT.
Immunogen
CROT (NP_066974, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWLEEWWLNVAYLDVRIPSQL
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (85); Rat (84)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CROT monoclonal antibody (M01), clone 1A6. Western Blot analysis of CROT expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
CROT monoclonal antibody (M01), clone 1A6 Western Blot analysis of CROT expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
CROT monoclonal antibody (M01), clone 1A6. Western Blot analysis of CROT expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
CROT monoclonal antibody (M01), clone 1A6. Western Blot analysis of CROT expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — CROT
Entrez GeneID
54677GeneBank Accession#
NM_021151Protein Accession#
NP_066974Gene Name
CROT
Gene Alias
COT
Gene Description
carnitine O-octanoyltransferase
Omim ID
606090Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the carnitine/choline acetyltransferase family. The encoded protein converts 4,8-dimethylnonanoyl-CoA to its corresponding carnitine ester. This transesterification occurs in the peroxisome and is necessary for transport of medium- and long- chain acyl-CoA molecules out of the peroxisome to the cytosol and mitochondria. The protein thus plays a role in lipid metabolism and fatty acid beta-oxidation. Alternatively spliced transcript variants have been described
Other Designations
peroxisomal carnitine O-octanoyltransferase|peroxisomal carnitine acyltransferase|peroxisomal carnitine octanoyltransferase
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com