UGT1A3 monoclonal antibody (M02), clone 1C10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant UGT1A3.
Immunogen
UGT1A3 (NP_061966, 30 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KVLVVPIDGSHWLSMREVLRELHARGHQAVVLTPEVNMHIKEENFFTLTTYAISWTQDEFDRHVLGHTQLYFETEHFLKKFFRSMAMLNNMSLVYHRSCV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75); Rat (77)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UGT1A3 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — UGT1A3
Entrez GeneID
54659GeneBank Accession#
NM_019093Protein Accession#
NP_061966Gene Name
UGT1A3
Gene Alias
UGT1C
Gene Description
UDP glucuronosyltransferase 1 family, polypeptide A3
Omim ID
606428Gene Ontology
HyperlinkGene Summary
This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. Substrates of this enzyme include estrone, 2-hydroxyestrone, and metabolites of benzo alpha-pyrene. [provided by RefSeq
Other Designations
OTTHUMP00000065193|UDP glucuronosyltransferase 1A3|UDP glycosyltransferase 1 family, polypeptide A3|UDP-glucuronosyltransferase
-
Interactome
-
Pathway
- Androgen and estrogen metabolism
- Ascorbate and aldarate metabolism
- Drug metabolism - cytochrome P450
- Drug metabolism - other enzymes
- Metabolic pathways
- Metabolism of xenobiotics by cytochrome P450
- Pentose and glucuronate interconversions
- Porphyrin and chlorophyll metabolism
- Retinol metabolism
+ View More Disease
-
Disease
-
Publication Reference
-
A Gilbert Syndrome-Associated Haplotype Protects Against Fatty Liver Disease in Humanized Transgenic Mice.
Steffen Landerer, Sandra Kalthoff, Stefan Paulusch, Christian P Strassburg.
Scientific Reports 2020 May; 10(1):8689.
Application:WB-Ti, Mouse, Mouse livers.
-
Combination of hesperetin and platinum enhances anticancer effect on lung adenocarcinoma.
Wang Y, Liu S, Dong W, Qu X, Huang C, Yan T, Du J.
Biomedicine & Pharmacotherapy 2019 May; 113:108779.
Application:WB, Human, A549 cells, NSCLC tissues.
-
Coffee induces expression of glucuronosyltransferases via the aryl hydrocarbon receptor and Nrf2 in liver and stomach.
Kalthoff S, Ehmer U, Freiberg N, Manns MP, Strassburg CP.
Gastroenterology 2010 Nov; 139(5):1699.
Application:WB, Human, KYSE70 cells.
-
A Gilbert Syndrome-Associated Haplotype Protects Against Fatty Liver Disease in Humanized Transgenic Mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com