UGT1A3 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant UGT1A3.
Immunogen
UGT1A3 (NP_061966, 30 a.a. ~ 129 a.a) partial recombinant protein with GST tag.
Sequence
KVLVVPIDGSHWLSMREVLRELHARGHQAVVLTPEVNMHIKEENFFTLTTYAISWTQDEFDRHVLGHTQLYFETEHFLKKFFRSMAMLNNMSLVYHRSCV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75); Rat (77)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — UGT1A3
Entrez GeneID
54659GeneBank Accession#
NM_019093Protein Accession#
NP_061966Gene Name
UGT1A3
Gene Alias
UGT1C
Gene Description
UDP glucuronosyltransferase 1 family, polypeptide A3
Omim ID
606428Gene Ontology
HyperlinkGene Summary
This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. Substrates of this enzyme include estrone, 2-hydroxyestrone, and metabolites of benzo alpha-pyrene. [provided by RefSeq
Other Designations
OTTHUMP00000065193|UDP glucuronosyltransferase 1A3|UDP glycosyltransferase 1 family, polypeptide A3|UDP-glucuronosyltransferase
-
Interactome
-
Pathway
- Androgen and estrogen metabolism
- Ascorbate and aldarate metabolism
- Drug metabolism - cytochrome P450
- Drug metabolism - other enzymes
- Metabolic pathways
- Metabolism of xenobiotics by cytochrome P450
- Pentose and glucuronate interconversions
- Porphyrin and chlorophyll metabolism
- Retinol metabolism
+ View More Disease
-
Disease
-
Publication Reference
-
USF1 Transcriptionally Regulates UGT1A3 and Promotes Lung Adenocarcinoma Progression by Regulating Neurotrophin Signaling Pathway.
Yu Wang, Yun-Xia Zhao, Xiang-Wei Zhang, Yuan-Zhu Jiang, Wei Ma, Lin Zhang, Wei Dong.
Frontiers in Molecular Biosciences 2022 Jan; 9:758968.
Application:WB-Tr, Human, H1299 cells.
-
USF1 Transcriptionally Regulates UGT1A3 and Promotes Lung Adenocarcinoma Progression by Regulating Neurotrophin Signaling Pathway.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com