Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UGT1A1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00054658-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human UGT1A1 partial ORF ( NP_000454.1, 54 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • GHEIVVLAPDASLYIRDGAFYTLKTYPVPFQREDVKESFVSLGHNVFENDSFLQRVIKTYKKIKKDSAMLLSGCSHLLHNKELMASLAESSFDVMLTDPFLPCSPI
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.4
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00054658-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • UGT1A1
  • Gene Alias:
  • GNT1,HUG-BR1,UDPGT,UGT1,UGT1A
  • Gene Description:
  • UDP glucuronosyltransferase 1 family, polypeptide A1
  • Gene Summary:
  • This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The preferred substrate of this enzyme is bilirubin, although it also has moderate activity with simple phenols, flavones, and C18 steroids. Mutations in this gene result in Crigler-Najjar syndromes types I and II and in Gilbert syndrome. [provided by RefSeq
  • Other Designations:
  • UDP glucuronosyltransferase 1A1,UDP glycosyltransferase 1 family, polypeptide A1,bilirubin UDP-glucuronosyltransferase 1-1,bilirubin UDP-glucuronosyltransferase isozyme 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook