UGT1A1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human UGT1A1 partial ORF ( NP_000454.1, 54 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
GHEIVVLAPDASLYIRDGAFYTLKTYPVPFQREDVKESFVSLGHNVFENDSFLQRVIKTYKKIKKDSAMLLSGCSHLLHNKELMASLAESSFDVMLTDPFLPCSPI
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.4
Interspecies Antigen Sequence
Mouse (63); Rat (65)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — UGT1A1
Entrez GeneID
54658GeneBank Accession#
NM_000463Protein Accession#
NP_000454.1Gene Name
UGT1A1
Gene Alias
GNT1, HUG-BR1, UDPGT, UGT1, UGT1A
Gene Description
UDP glucuronosyltransferase 1 family, polypeptide A1
Gene Ontology
HyperlinkGene Summary
This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The preferred substrate of this enzyme is bilirubin, although it also has moderate activity with simple phenols, flavones, and C18 steroids. Mutations in this gene result in Crigler-Najjar syndromes types I and II and in Gilbert syndrome. [provided by RefSeq
Other Designations
UDP glucuronosyltransferase 1A1|UDP glycosyltransferase 1 family, polypeptide A1|bilirubin UDP-glucuronosyltransferase 1-1|bilirubin UDP-glucuronosyltransferase isozyme 1
-
Pathway
- Androgen and estrogen metabolism
- Ascorbate and aldarate metabolism
- Drug metabolism - cytochrome P450
- Drug metabolism - other enzymes
- Metabolic pathways
- Metabolism of xenobiotics by cytochrome P450
- Pentose and glucuronate interconversions
- Porphyrin and chlorophyll metabolism
- Retinol metabolism
+ View More Disease
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com