DDX56 monoclonal antibody (M05), clone 4C5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DDX56.
Immunogen
DDX56 (NP_061955, 450 a.a. ~ 547 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IKEELLHSEKLKTYFEDNPRDLQLLRHDLPLHPAVVKPHLGHVPDYLVPPALRGLVRPHKKRKKLSSSCRKAKRAKSQNPLRSFKHKGKKFRPTAKPS
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DDX56 monoclonal antibody (M05), clone 4C5 Western Blot analysis of DDX56 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
DDX56 monoclonal antibody (M05), clone 4C5. Western Blot analysis of DDX56 expression in PC-12 ( Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of DDX56 expression in transfected 293T cell line by DDX56 monoclonal antibody (M05), clone 4C5.
Lane 1: DDX56 transfected lysate(62 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to DDX56 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DDX56 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to DDX56 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — DDX56
Entrez GeneID
54606GeneBank Accession#
NM_019082Protein Accession#
NP_061955Gene Name
DDX56
Gene Alias
DDX21, DDX26, NOH61
Gene Description
DEAD (Asp-Glu-Ala-Asp) box polypeptide 56
Omim ID
608023Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene shows ATPase activity in the presence of polynucleotides and associates with nucleoplasmic 65S preribosomal particles. This gene may be involved in ribosome synthesis, most likely during assembly of the large 60S ribosomal subunit. [provided by RefSeq
Other Designations
61-kd nucleolar helicase|DEAD-box RNA helicase|putative nucleolar RNA helicase
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com