DDX56 monoclonal antibody (M03), clone 6B9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DDX56.
Immunogen
DDX56 (NP_061955, 450 a.a. ~ 547 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IKEELLHSEKLKTYFEDNPRDLQLLRHDLPLHPAVVKPHLGHVPDYLVPPALRGLVRPHKKRKKLSSSCRKAKRAKSQNPLRSFKHKGKKFRPTAKPS
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in HepG2 ( Cat # L019V1 ).Western Blot (Cell lysate)
DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DDX56 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — DDX56
Entrez GeneID
54606GeneBank Accession#
NM_019082Protein Accession#
NP_061955Gene Name
DDX56
Gene Alias
DDX21, DDX26, NOH61
Gene Description
DEAD (Asp-Glu-Ala-Asp) box polypeptide 56
Omim ID
608023Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene shows ATPase activity in the presence of polynucleotides and associates with nucleoplasmic 65S preribosomal particles. This gene may be involved in ribosome synthesis, most likely during assembly of the large 60S ribosomal subunit. [provided by RefSeq
Other Designations
61-kd nucleolar helicase|DEAD-box RNA helicase|putative nucleolar RNA helicase
-
Interactome
-
Publication Reference
-
Quantitative Proteomics and Dynamic Imaging of the Nucleolus Reveal Distinct Responses to UV and Ionizing Radiation.
Moore HM, Bai B, Boisvert FM, Latonen L, Rantanen V, Simpson JC, Pepperkok R, Lamond AI, Laiho M.
Mol Cell Proteomics 2011 Jul; 10:M111.00924.
Application:IF, Human, U2OS cells.
-
Quantitative Proteomics and Dynamic Imaging of the Nucleolus Reveal Distinct Responses to UV and Ionizing Radiation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com