Product Browser

Last updated: 2017/3/19
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LZTFL1 monoclonal antibody (M09), clone 1B1

  • Catalog # : H00054585-M09
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant LZTFL1.
  • Immunogen:
  • LZTFL1 (AAH25988.1, 39 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • LKESRLVEDTFTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELENQELLEQVAEFEKA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00054585-M09
    Western Blot detection against Immunogen (34.65 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of LZTFL1 expression in transfected 293T cell line by LZTFL1 monoclonal antibody (M09), clone 1B1.

    Lane 1: LZTFL1 transfected lysate(34.6 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of LZTFL1 transfected lysate using anti-LZTFL1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with LZTFL1 MaxPab rabbit polyclonal antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • LZTFL1
  • Gene Alias:
  • FLJ36386
  • Gene Description:
  • leucine zipper transcription factor-like 1
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook