LZTFL1 monoclonal antibody (M01), clone 7F6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LZTFL1.
Immunogen
LZTFL1 (NP_065080, 200 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KDFIKAQDLSNLENTVAALKSEFQKTLNDKTENQKSLEENLATAKHDLLRVQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (92)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
LZTFL1 monoclonal antibody (M01), clone 7F6 Western Blot analysis of LZTFL1 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of LZTFL1 expression in transfected 293T cell line by LZTFL1 monoclonal antibody (M01), clone 7F6.
Lane 1: LZTFL1 transfected lysate(34.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to LZTFL1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LZTFL1 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to LZTFL1 on HeLa cell. [antibody concentration 25 ug/ml] -
Gene Info — LZTFL1
-
Interactome
-
Publication Reference
-
A Novel Protein LZTFL1 Regulates Ciliary Trafficking of the BBSome and Smoothened.
Seo S, Zhang Q, Bugge K, Breslow DK, Searby CC, Nachury MV, Sheffield VC.
PLoS Genetics 2011 Nov; 7(11):e1002358.
Application:IF, PLA-Ce, WB-Ti, WB-Tr, Human, Mouse, Eyes, hTERT-RPE1 cells, Testes.
-
A Novel Protein LZTFL1 Regulates Ciliary Trafficking of the BBSome and Smoothened.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com