SCAND2 (Human) Recombinant Protein (Q02)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SCAND2 partial ORF ( NP_071333, 1 a.a. - 62 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAVAVDQQIQTPSVQDLQIVKLEEDSHWEQEISLQGNYPGPETSCQSFWHFRYQEASRPREA
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
32.56
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SCAND2
Entrez GeneID
54581GeneBank Accession#
NM_022050Protein Accession#
NP_071333Gene Name
SCAND2
Gene Alias
-
Gene Description
SCAN domain containing 2 pseudogene
Omim ID
610417Gene Ontology
HyperlinkGene Summary
The SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa originally found within a subfamily of zinc finger proteins. This gene belongs to a family of genes that encode an isolated SCAN domain, but no zinc finger motif. Functional studies have established that the SCAN box is a protein interaction domain that mediates both hetero- and homoprotein associations, and maybe involved in regulation of transcriptional activity. Multiple transcript variants which encode the same isoform but differ only in their 3' UTRs, and another variant which encodes a distinct isoform have been described for this gene.
Other Designations
-
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com