SCAND2 monoclonal antibody (M01), clone 7B12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SCAND2.
Immunogen
SCAND2 (NP_071333, 1 a.a. ~ 62 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAVAVDQQIQTPSVQDLQIVKLEEDSHWEQEISLQGNYPGPETSCQSFWHFRYQEASRPREA
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.56 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SCAND2 monoclonal antibody (M01), clone 7B12 Western Blot analysis of SCAND2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of SCAND2 over-expressed 293 cell line, cotransfected with SCAND2 Validated Chimera RNAi ( Cat # H00054581-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SCAND2 monoclonal antibody (M01), clone 7B12 (Cat # H00054581-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to SCAND2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — SCAND2
Entrez GeneID
54581GeneBank Accession#
NM_022050Protein Accession#
NP_071333Gene Name
SCAND2
Gene Alias
-
Gene Description
SCAN domain containing 2 pseudogene
Omim ID
610417Gene Ontology
HyperlinkGene Summary
The SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa originally found within a subfamily of zinc finger proteins. This gene belongs to a family of genes that encode an isolated SCAN domain, but no zinc finger motif. Functional studies have established that the SCAN box is a protein interaction domain that mediates both hetero- and homoprotein associations, and maybe involved in regulation of transcriptional activity. Multiple transcript variants which encode the same isoform but differ only in their 3' UTRs, and another variant which encodes a distinct isoform have been described for this gene.
Other Designations
-
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com