UGT1A10 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human UGT1A10 partial ORF ( NP_061948, 187 a.a. - 289 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LSYVPNDLLGFSDAMTFKERVWNHIVHLEDHLFCQYLFRNALEIASEILQTPVTAYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEA
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.07
Interspecies Antigen Sequence
Mouse (78); Rat (78)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — UGT1A10
Entrez GeneID
54575GeneBank Accession#
NM_019075Protein Accession#
NP_061948Gene Name
UGT1A10
Gene Alias
UDPGT, UGT1J
Gene Description
UDP glucuronosyltransferase 1 family, polypeptide A10
Omim ID
606435Gene Ontology
HyperlinkGene Summary
This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has glucuronidase activity on mycophenolic acid, coumarins, and quinolines. [provided by RefSeq
Other Designations
OTTHUMP00000065196|UDP glycosyltransferase 1 family, polypeptide A10|UDP-glucuronosyltransferase 1A10
-
Interactome
-
Pathway
- Androgen and estrogen metabolism
- Ascorbate and aldarate metabolism
- Drug metabolism - cytochrome P450
- Drug metabolism - other enzymes
- Metabolic pathways
- Metabolism of xenobiotics by cytochrome P450
- Pentose and glucuronate interconversions
- Porphyrin and chlorophyll metabolism
- Retinol metabolism
+ View More Disease
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com